(data stored in ACNUC7421 zone)

EMBL: CP000272.PE193

CP000272.PE193       Location/Qualifiers
FT   CDS             complement(217765..219372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0197"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36121"
FT                   /db_xref="GOA:Q13IG8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG8"
FT                   /protein_id="ABE36121.1"
FT                   /translation="MKLVLRNVLAAAALASALTCSFTAADPAAAATPKDMFVMATFLDE
FT                   FTTLDPGEVYELVPEEYVANTYDRLVRVDLKDPSKFNGDVAQSWTVSPDGLTFTFKLRA
FT                   GLKFHSGNPLSADDVAWSIQRTVLLDKGAAAVLQGIGLTRDNVLANVKKVDDTTVSVTT
FT                   DRKYAPTFVLNVLGAWPASVVDKQLLLAHQKGNDFGNDWLRTNEAGSGAYKLVKWTAND
FT                   SLVLQRFDGYRLPLAMKRIVLRHVPEASSQRLLIENGDVDVARNLSPDDLAALTKSGKA
FT                   HVTAVPQATLLYLGLNVRNPNLAKPEVQEAMKWLIDYNGIQSNVAKTTYKVHQTFLPEG
FT                   FLGVLNTNPYQQDVAKAKALLAKAGLPNGFSVTMDVRNGYPYSEIAEAVQADLAQGGIK
FT                   VQIIPGDNKQTLAKYRSRSHDIYIGEWSADYIDPHSNAQGFAWNPDNSDKSAYKMLAWR
FT                   NSWDIPDLTKETNAALAESSTAKRAELYQTMQKQMLANSPFVILFQQVSQVAARPGVTG
FT                   LEVGPINDLVSYRDLKKQ"
     MKLVLRNVLA AAALASALTC SFTAADPAAA ATPKDMFVMA TFLDEFTTLD PGEVYELVPE        60
     EYVANTYDRL VRVDLKDPSK FNGDVAQSWT VSPDGLTFTF KLRAGLKFHS GNPLSADDVA       120
     WSIQRTVLLD KGAAAVLQGI GLTRDNVLAN VKKVDDTTVS VTTDRKYAPT FVLNVLGAWP       180
     ASVVDKQLLL AHQKGNDFGN DWLRTNEAGS GAYKLVKWTA NDSLVLQRFD GYRLPLAMKR       240
     IVLRHVPEAS SQRLLIENGD VDVARNLSPD DLAALTKSGK AHVTAVPQAT LLYLGLNVRN       300
     PNLAKPEVQE AMKWLIDYNG IQSNVAKTTY KVHQTFLPEG FLGVLNTNPY QQDVAKAKAL       360
     LAKAGLPNGF SVTMDVRNGY PYSEIAEAVQ ADLAQGGIKV QIIPGDNKQT LAKYRSRSHD       420
     IYIGEWSADY IDPHSNAQGF AWNPDNSDKS AYKMLAWRNS WDIPDLTKET NAALAESSTA       480
     KRAELYQTMQ KQMLANSPFV ILFQQVSQVA ARPGVTGLEV GPINDLVSYR DLKKQ            535
//

If you have problems or comments...

PBIL Back to PBIL home page