(data stored in ACNUC7421 zone)

EMBL: CP000272.PE196

CP000272.PE196       Location/Qualifiers
FT   CDS             220526..220864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36124"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG5"
FT                   /protein_id="ABE36124.1"
FT                   /translation="MARERLITEKEAGALVERLAAQLLSSSHSLRASVCAIHQALLKPG
FT                   CSIGCWTIFTRTEQISRIYLLEILHKFCQQCAAFLQLGSVKWEVLRAHCVCCLLAGNTS
FT                   SLINLIQT"
     MARERLITEK EAGALVERLA AQLLSSSHSL RASVCAIHQA LLKPGCSIGC WTIFTRTEQI        60
     SRIYLLEILH KFCQQCAAFL QLGSVKWEVL RAHCVCCLLA GNTSSLINLI QT               112
//

If you have problems or comments...

PBIL Back to PBIL home page