(data stored in ACNUC7421 zone)

EMBL: CP000272.PE205

CP000272.PE205       Location/Qualifiers
FT   CDS             231582..232205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36133"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF6"
FT                   /protein_id="ABE36133.1"
FT                   /translation="MGGDAGSAGGGHRVNHIGPMSLPMQRRMFAVVGASDSVQRRRRAR
FT                   AFNRPAASAYSAYYAFTRRTVFCVGVPAQRGSIRMNQACGAGPGPMRIGVSGIADRRSR
FT                   ARRRQWNRNAGTLARERSSRVGHVPCAPQRSVNLSCERGATMQTDPTVDPVADPANQPL
FT                   DEPDTHPRPLPGSPPDTDPLAPGSSPEDEEELGDSQSSSPVQRD"
     MGGDAGSAGG GHRVNHIGPM SLPMQRRMFA VVGASDSVQR RRRARAFNRP AASAYSAYYA        60
     FTRRTVFCVG VPAQRGSIRM NQACGAGPGP MRIGVSGIAD RRSRARRRQW NRNAGTLARE       120
     RSSRVGHVPC APQRSVNLSC ERGATMQTDP TVDPVADPAN QPLDEPDTHP RPLPGSPPDT       180
     DPLAPGSSPE DEEELGDSQS SSPVQRD                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page