(data stored in ACNUC7421 zone)

EMBL: CP000272.PE206

CP000272.PE206       Location/Qualifiers
FT   CDS             232332..232589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36134"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF5"
FT                   /protein_id="ABE36134.1"
FT                   /translation="MAGAERLFQVLIATLDAPAHFSCFACTAARSKARRSFKADRVDER
FT                   VATHRYPGAYCAMSASVHLLRPATIKKTHRHVWQEKDACP"
     MAGAERLFQV LIATLDAPAH FSCFACTAAR SKARRSFKAD RVDERVATHR YPGAYCAMSA        60
     SVHLLRPATI KKTHRHVWQE KDACP                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page