(data stored in SCRATCH zone)

EMBL: CP000272.PE21

CP000272.PE21        Location/Qualifiers
FT   CDS             28889..29749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0022"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35949"
FT                   /db_xref="GOA:Q13IZ0"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ0"
FT                   /protein_id="ABE35949.1"
FT                   /translation="MNDRQDIAPDSTAARVALWRALHVELDPPPHVMEDEIGLQLLAPG
FT                   EDWRHRGDMDPRFTRPFRASIVARARFVEDLVVEQAGRGLTQYVILGAGLDSFAQRRPE
FT                   IASRLRVFEIDRPGPQAWKRQRLVELGFGMPDWLRFVPVDFGAGQGWRGGLATAGFDDS
FT                   KPAIVVSTGLSMYLTRDANAATLREVAALAPGSTLAMTFLLPLERADPELRPALEMAEK
FT                   GARAGGTPFLSFFTPAELVALAHQSGFGEARHVSAADLTRRYFADRTDGLRPPNNAEEL
FT                   LVAKT"
     MNDRQDIAPD STAARVALWR ALHVELDPPP HVMEDEIGLQ LLAPGEDWRH RGDMDPRFTR        60
     PFRASIVARA RFVEDLVVEQ AGRGLTQYVI LGAGLDSFAQ RRPEIASRLR VFEIDRPGPQ       120
     AWKRQRLVEL GFGMPDWLRF VPVDFGAGQG WRGGLATAGF DDSKPAIVVS TGLSMYLTRD       180
     ANAATLREVA ALAPGSTLAM TFLLPLERAD PELRPALEMA EKGARAGGTP FLSFFTPAEL       240
     VALAHQSGFG EARHVSAADL TRRYFADRTD GLRPPNNAEE LLVAKT                      286
//

If you have problems or comments...

PBIL Back to PBIL home page