(data stored in ACNUC7421 zone)

EMBL: CP000272.PE212

CP000272.PE212       Location/Qualifiers
FT   CDS             236965..238005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0216"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36140"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE9"
FT                   /protein_id="ABE36140.1"
FT                   /translation="MLEAWKTVLSLSNLQPGQTVTVLTGATSHPQSVSTALTAATAMRA
FT                   VVNRLDLQPINGEKALSRDSLAYLGTTPLTGNRAAIAALSASDIVLDLMTLLFSPEQHE
FT                   ILKSGAKILLAVEPPEVLVRMVPSVEDRGRVKAAADRLARAKLMQVRNDAGTDLLCPLG
FT                   QYPAISEYGFVDEPGRWDHWPSGFALTWPNEGETQGTIVLSPGDILLPQKSYIRSEIRL
FT                   VMKDGFAVSIEGGMDADLLSEYMASFEDPEAYAMSHIGWGLQPRAHWSTLGLYDREATL
FT                   GMDARAFEGNFLFSLGPNNEAGGTRTTACHIDIPMRNCTVTLDGEPVVTRGKVHAQQPG
FT                   SQKTHA"
     MLEAWKTVLS LSNLQPGQTV TVLTGATSHP QSVSTALTAA TAMRAVVNRL DLQPINGEKA        60
     LSRDSLAYLG TTPLTGNRAA IAALSASDIV LDLMTLLFSP EQHEILKSGA KILLAVEPPE       120
     VLVRMVPSVE DRGRVKAAAD RLARAKLMQV RNDAGTDLLC PLGQYPAISE YGFVDEPGRW       180
     DHWPSGFALT WPNEGETQGT IVLSPGDILL PQKSYIRSEI RLVMKDGFAV SIEGGMDADL       240
     LSEYMASFED PEAYAMSHIG WGLQPRAHWS TLGLYDREAT LGMDARAFEG NFLFSLGPNN       300
     EAGGTRTTAC HIDIPMRNCT VTLDGEPVVT RGKVHAQQPG SQKTHA                      346
//

If you have problems or comments...

PBIL Back to PBIL home page