(data stored in ACNUC7421 zone)

EMBL: CP000272.PE215

CP000272.PE215       Location/Qualifiers
FT   CDS             240129..241259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0219"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36143"
FT                   /db_xref="GOA:Q13IE6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE6"
FT                   /protein_id="ABE36143.1"
FT                   /translation="MTFALCVTAAGTLACQAARAAEPVRIGLIQPLTGSVAYNGHADVN
FT                   GAKLAVAEINKAGGVLGRPVELKIEDGQCNPANTVNAAEKLIQKDRVSALIGAFCSSST
FT                   AAIMPVAQKYHLPLVTGVSSEADLTEKGNPWFFRAAETDQLLAHAFAPTIIRTLQLKSV
FT                   AYVGVNDDWGRGSVQEFQQSLQAGGVKTVSTDYFDHGATDFYTLLTKLRASGADAVFVA
FT                   AETQDGSILVKQIKELGLHIKVFGVGSWATADFIDLAGPAAEGVYAAVPYASTLTTPEN
FT                   TAFVASYQTAYKAAPGKYSAAGYNAVEIVAKAIARAGSTDADKIRAALAQTDFAAPNGR
FT                   YRFTAKGQAYGFSVVLVQIHNKAPQVVATTPVSAPH"
     MTFALCVTAA GTLACQAARA AEPVRIGLIQ PLTGSVAYNG HADVNGAKLA VAEINKAGGV        60
     LGRPVELKIE DGQCNPANTV NAAEKLIQKD RVSALIGAFC SSSTAAIMPV AQKYHLPLVT       120
     GVSSEADLTE KGNPWFFRAA ETDQLLAHAF APTIIRTLQL KSVAYVGVND DWGRGSVQEF       180
     QQSLQAGGVK TVSTDYFDHG ATDFYTLLTK LRASGADAVF VAAETQDGSI LVKQIKELGL       240
     HIKVFGVGSW ATADFIDLAG PAAEGVYAAV PYASTLTTPE NTAFVASYQT AYKAAPGKYS       300
     AAGYNAVEIV AKAIARAGST DADKIRAALA QTDFAAPNGR YRFTAKGQAY GFSVVLVQIH       360
     NKAPQVVATT PVSAPH                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page