(data stored in ACNUC7421 zone)

EMBL: CP000272.PE216

CP000272.PE216       Location/Qualifiers
FT   CDS             241287..242159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0220"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36144"
FT                   /db_xref="GOA:Q13IE5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE5"
FT                   /protein_id="ABE36144.1"
FT                   /translation="MDLLLQFLVNGVVIGVFYALSALGLTLIFGLMRVVNFAHGEFYML
FT                   GGILGWFVTTRLGLDFFSGLAIVAVVMAAFGWVIDRLLIERVRHQGEEAGILLTIGLSI
FT                   VIANVALLVVGTAPHKVVGPVSDAPVLLGPVVLTRVRLVALAIAALLVAAAHGLIHRTT
FT                   LGRAMRATFQDPMAARLAGIRTERIYASTFALGTTIAALSGMLLASIYSAQVSIGGTVS
FT                   LKAFVVVILGGMGSFAGAIVGGLVLGIVEAMWGGYLSTNLVDLVGFVLVIALLLFRPYG
FT                   LFSLRAERA"
     MDLLLQFLVN GVVIGVFYAL SALGLTLIFG LMRVVNFAHG EFYMLGGILG WFVTTRLGLD        60
     FFSGLAIVAV VMAAFGWVID RLLIERVRHQ GEEAGILLTI GLSIVIANVA LLVVGTAPHK       120
     VVGPVSDAPV LLGPVVLTRV RLVALAIAAL LVAAAHGLIH RTTLGRAMRA TFQDPMAARL       180
     AGIRTERIYA STFALGTTIA ALSGMLLASI YSAQVSIGGT VSLKAFVVVI LGGMGSFAGA       240
     IVGGLVLGIV EAMWGGYLST NLVDLVGFVL VIALLLFRPY GLFSLRAERA                  290
//

If you have problems or comments...

PBIL Back to PBIL home page