(data stored in ACNUC7421 zone)

EMBL: CP000272.PE218

CP000272.PE218       Location/Qualifiers
FT   CDS             243147..243935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0222"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36146"
FT                   /db_xref="GOA:Q13IE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE3"
FT                   /protein_id="ABE36146.1"
FT                   /translation="MEQVRTDCILQVDRLCKRFGGVAAVRDVSFDLKRGEILGLVGPNG
FT                   AGKTSCFNLITGFYRPDSGDVLFEGRPLTGMKPHRIARAGVVRSFQKTNVLKPLSVFEN
FT                   VLAGHYLAARQSLWRVFFPGQAVRDAETRVRREAKRIVDLMGLGKRIDSPAYLLSCGEL
FT                   RLLEVAMALAAKPRLLMLDEPAAGLNTQEAVVLGKVLRELRDREVEAIILVEHNMNLVT
FT                   NTCDRLVVMNFGEKLAEGAPRDILHDPRVVEAYLGKAHAA"
     MEQVRTDCIL QVDRLCKRFG GVAAVRDVSF DLKRGEILGL VGPNGAGKTS CFNLITGFYR        60
     PDSGDVLFEG RPLTGMKPHR IARAGVVRSF QKTNVLKPLS VFENVLAGHY LAARQSLWRV       120
     FFPGQAVRDA ETRVRREAKR IVDLMGLGKR IDSPAYLLSC GELRLLEVAM ALAAKPRLLM       180
     LDEPAAGLNT QEAVVLGKVL RELRDREVEA IILVEHNMNL VTNTCDRLVV MNFGEKLAEG       240
     APRDILHDPR VVEAYLGKAH AA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page