(data stored in SCRATCH zone)

EMBL: CP000272.PE219

CP000272.PE219       Location/Qualifiers
FT   CDS             243932..244657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0223"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36147"
FT                   /db_xref="GOA:Q13IE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE2"
FT                   /protein_id="ABE36147.1"
FT                   /translation="MNASAQPVLTVSDIHVAYGKTKALHGVSLEVACGEVIALIGANGA
FT                   GKSTMLRAISGLLPLSAGAIHWNGNSIGGLAADRIVASGIAHCPEERHVWPAMTVLENL
FT                   SLGAYLCRSREVVARRTELAFERFPRLRERSSQLAGTLSGGEQQMLAIARALMSEPRLL
FT                   LLDEPSLGLSPKVAHEILDVIRAINEHGVTVLLVEQNVHNALSVAKRAYVFETGQIAAT
FT                   RTAEELLGDNELLAAYLGG"
     MNASAQPVLT VSDIHVAYGK TKALHGVSLE VACGEVIALI GANGAGKSTM LRAISGLLPL        60
     SAGAIHWNGN SIGGLAADRI VASGIAHCPE ERHVWPAMTV LENLSLGAYL CRSREVVARR       120
     TELAFERFPR LRERSSQLAG TLSGGEQQML AIARALMSEP RLLLLDEPSL GLSPKVAHEI       180
     LDVIRAINEH GVTVLLVEQN VHNALSVAKR AYVFETGQIA ATRTAEELLG DNELLAAYLG       240
     G                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page