(data stored in ACNUC7421 zone)

EMBL: CP000272.PE222

CP000272.PE222       Location/Qualifiers
FT   CDS             complement(245567..246289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0226"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36150"
FT                   /db_xref="GOA:Q13ID9"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID9"
FT                   /protein_id="ABE36150.1"
FT                   /translation="MSDTYSSLIVKGALWALVLFSIVTWALILAKGTQSWRVARNNQRF
FT                   QKAFWSAGDLPQAAALGNPRDSALGRVAHAAFTALTETSEGLHDLEHSWDRLESLERLL
FT                   RQQIVKERGSLESGLAILASVGSTAPFVGLFGTVFGIVHAMTAISQNGTADIGVVAGPI
FT                   GEALVTTGVGIAVAVPAVLAYNFFVRRLKVTGGVLDDFGTDLISLAQKSNFRIRPFNRA
FT                   APDESTAPIDATSEGAYV"
     MSDTYSSLIV KGALWALVLF SIVTWALILA KGTQSWRVAR NNQRFQKAFW SAGDLPQAAA        60
     LGNPRDSALG RVAHAAFTAL TETSEGLHDL EHSWDRLESL ERLLRQQIVK ERGSLESGLA       120
     ILASVGSTAP FVGLFGTVFG IVHAMTAISQ NGTADIGVVA GPIGEALVTT GVGIAVAVPA       180
     VLAYNFFVRR LKVTGGVLDD FGTDLISLAQ KSNFRIRPFN RAAPDESTAP IDATSEGAYV       240
//

If you have problems or comments...

PBIL Back to PBIL home page