(data stored in ACNUC7421 zone)

EMBL: CP000272.PE225

CP000272.PE225       Location/Qualifiers
FT   CDS             248765..249532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0229"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36153"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID6"
FT                   /protein_id="ABE36153.1"
FT                   /translation="MTATITGKPTSKQRRRFMRNAVAGAALSGGVRSAMAQPVAIGASA
FT                   TRSSAPAVAAANTAAPIVPAGYAFLRPAEADFVEALVDHMVPADELTGSGTALGLNQYF
FT                   DRTLGGAWGDGAGLYLEGPWHAGTPAQGYQLPLTPAELFRVGTDALRSYCSGHFGKPFA
FT                   SLDAQQKETLLHALNDGQVVLEGCPDTKRYFALLHQLVNEGLFADPLYGGNVGKAGWRL
FT                   VGFPGVIAEHEKDVRIYRNSPYSAPVLSIGDAS"
     MTATITGKPT SKQRRRFMRN AVAGAALSGG VRSAMAQPVA IGASATRSSA PAVAAANTAA        60
     PIVPAGYAFL RPAEADFVEA LVDHMVPADE LTGSGTALGL NQYFDRTLGG AWGDGAGLYL       120
     EGPWHAGTPA QGYQLPLTPA ELFRVGTDAL RSYCSGHFGK PFASLDAQQK ETLLHALNDG       180
     QVVLEGCPDT KRYFALLHQL VNEGLFADPL YGGNVGKAGW RLVGFPGVIA EHEKDVRIYR       240
     NSPYSAPVLS IGDAS                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page