(data stored in ACNUC7421 zone)

EMBL: CP000272.PE227

CP000272.PE227       Location/Qualifiers
FT   CDS             251408..253723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0231"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36155"
FT                   /db_xref="GOA:Q13ID4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID4"
FT                   /protein_id="ABE36155.1"
FT                   /translation="MLRRKYNKRTTGSLRYDAAVLQCGRESGRFALNAGAMKLLPFSLI
FT                   SALATGFAHAQEPTAAPSAASSTTAATPFAASQAATATTVSATAATSTTLPEVTVTAER
FT                   HVTDLKKTPVSVGVLGADRFTTGGVAQPGDLNAATASLVAGGPSQRTAGSGGIYIRGIG
FT                   TGSPTYSSAVALYVDDVYIPRSLGNGLYMAFPDVERVEVLRGPQGTLYGMNSSAGARKV
FT                   ISLDPTDNSAWIQGTAGSYGALGVKAYVSHEIKPGLLYFSLAYGRYKDDGYTNDPVIGR
FT                   SIDSTNTEVLRGKVRLTPTADTEALFSYDIERDRSDTYSYIAPNYPGSGIRTSYENTDP
FT                   SIDRDISGVSLRLTKKFGDHLSLRSITAHRWISDGRYPLTQDGVPTDLYGWLLNIDQHQ
FT                   TSQEFQFNGDYDRFSFTTGAVYFSEDVTDFRPSWTSGVYKGIVSQIENKSYAAYAQGHY
FT                   KITPQFGVTAGIRVNRDEQNYQNTGFASNAALQVLGTTFQTGQLTQNVNSVTPKIGIDY
FT                   QWNPNIFSYASITKGEKSGGYNPVAASLAISQIAVSPERVLTYELGNKLTFWGGRAQLN
FT                   TALFYNDFDDYQAAIGNAIINGQLINGSVTVNAGKARTYGAEFELTARPVSDLNVNTWL
FT                   TVQQAEFQQFVNPTGAPTGNYVGNQLPYASHIIAGVHATYRLPLHVPGTTRIGATVRFL
FT                   SHSYIDIANQQPLGAQTYIDAMAEYTSPSSNWTATFEVRNLLNRAYVLGYNVTPSIGLN
FT                   AYNYSPPRTFMVSLRRDF"
     MLRRKYNKRT TGSLRYDAAV LQCGRESGRF ALNAGAMKLL PFSLISALAT GFAHAQEPTA        60
     APSAASSTTA ATPFAASQAA TATTVSATAA TSTTLPEVTV TAERHVTDLK KTPVSVGVLG       120
     ADRFTTGGVA QPGDLNAATA SLVAGGPSQR TAGSGGIYIR GIGTGSPTYS SAVALYVDDV       180
     YIPRSLGNGL YMAFPDVERV EVLRGPQGTL YGMNSSAGAR KVISLDPTDN SAWIQGTAGS       240
     YGALGVKAYV SHEIKPGLLY FSLAYGRYKD DGYTNDPVIG RSIDSTNTEV LRGKVRLTPT       300
     ADTEALFSYD IERDRSDTYS YIAPNYPGSG IRTSYENTDP SIDRDISGVS LRLTKKFGDH       360
     LSLRSITAHR WISDGRYPLT QDGVPTDLYG WLLNIDQHQT SQEFQFNGDY DRFSFTTGAV       420
     YFSEDVTDFR PSWTSGVYKG IVSQIENKSY AAYAQGHYKI TPQFGVTAGI RVNRDEQNYQ       480
     NTGFASNAAL QVLGTTFQTG QLTQNVNSVT PKIGIDYQWN PNIFSYASIT KGEKSGGYNP       540
     VAASLAISQI AVSPERVLTY ELGNKLTFWG GRAQLNTALF YNDFDDYQAA IGNAIINGQL       600
     INGSVTVNAG KARTYGAEFE LTARPVSDLN VNTWLTVQQA EFQQFVNPTG APTGNYVGNQ       660
     LPYASHIIAG VHATYRLPLH VPGTTRIGAT VRFLSHSYID IANQQPLGAQ TYIDAMAEYT       720
     SPSSNWTATF EVRNLLNRAY VLGYNVTPSI GLNAYNYSPP RTFMVSLRRD F                771
//

If you have problems or comments...

PBIL Back to PBIL home page