(data stored in ACNUC7421 zone)

EMBL: CP000272.PE23

CP000272.PE23        Location/Qualifiers
FT   CDS             30904..32124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0024"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35951"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY8"
FT                   /protein_id="ABE35951.1"
FT                   /translation="MDSLITAAARALAAGDPLGALDRIALRDDAPALALRGIAMAQLGD
FT                   LVRAKALVRSAARAFGADGAVARARCIVAEAEIALASRELGWPAKALDAARATLEAHGD
FT                   RLNAAHARYLEVRRLALVNRLREAEQTLAGLAPALLPPALRAVHELAVAELALRRLRTK
FT                   AARTALARAARAARRAGIPALTAEVEHASLVLSTPAARLIAHGEERLLLLDEVEALLAS
FT                   RGLVVDACRHAVRDADTVISLASRPVLFALARALGEAWPDDVPRDTLVARAFRARRADE
FT                   SYRARLRVEIGRLRAELGTLAGVSATRRGFALTPRGPAEVVVLAPLVEGEHAQVLAFLA
FT                   DGESWSSSALALVLGASQRTVQRALDSLATAGKVQSFGRGRARRWITPPVPGFATTLLL
FT                   PTFLSDD"
     MDSLITAAAR ALAAGDPLGA LDRIALRDDA PALALRGIAM AQLGDLVRAK ALVRSAARAF        60
     GADGAVARAR CIVAEAEIAL ASRELGWPAK ALDAARATLE AHGDRLNAAH ARYLEVRRLA       120
     LVNRLREAEQ TLAGLAPALL PPALRAVHEL AVAELALRRL RTKAARTALA RAARAARRAG       180
     IPALTAEVEH ASLVLSTPAA RLIAHGEERL LLLDEVEALL ASRGLVVDAC RHAVRDADTV       240
     ISLASRPVLF ALARALGEAW PDDVPRDTLV ARAFRARRAD ESYRARLRVE IGRLRAELGT       300
     LAGVSATRRG FALTPRGPAE VVVLAPLVEG EHAQVLAFLA DGESWSSSAL ALVLGASQRT       360
     VQRALDSLAT AGKVQSFGRG RARRWITPPV PGFATTLLLP TFLSDD                      406
//

If you have problems or comments...

PBIL Back to PBIL home page