(data stored in ACNUC7421 zone)

EMBL: CP000272.PE232

CP000272.PE232       Location/Qualifiers
FT   CDS             258135..258977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0236"
FT                   /product="ABC sulfate ester transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36160"
FT                   /db_xref="GOA:Q13IC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC9"
FT                   /protein_id="ABE36160.1"
FT                   /translation="MTFHQRAVFAGAAGPAARIARWFARWFARCAPLRHLIALPLPLAL
FT                   LLVWWTGYRAAWISPQVLPSIGQVVHALGAGWQSGDLQRDAGVSLLRVLAGFVLGGTLG
FT                   VPLGVAMGLSERIRDYVYPCFRIIAYVPLLGWLPLLVLVLGIGETLKIVLIAKAALVPI
FT                   TLNTYNGMRNVPAAYGELGAVFRFSRWQLIRHVVFPAAFPQIWSGVRYGLTQCWLLLVI
FT                   VEFLASDSGLGYMIISGQQLFQMDTVFAALLVIGVIGFLLDRGLRWLEACLFGEERRP"
     MTFHQRAVFA GAAGPAARIA RWFARWFARC APLRHLIALP LPLALLLVWW TGYRAAWISP        60
     QVLPSIGQVV HALGAGWQSG DLQRDAGVSL LRVLAGFVLG GTLGVPLGVA MGLSERIRDY       120
     VYPCFRIIAY VPLLGWLPLL VLVLGIGETL KIVLIAKAAL VPITLNTYNG MRNVPAAYGE       180
     LGAVFRFSRW QLIRHVVFPA AFPQIWSGVR YGLTQCWLLL VIVEFLASDS GLGYMIISGQ       240
     QLFQMDTVFA ALLVIGVIGF LLDRGLRWLE ACLFGEERRP                             280
//

If you have problems or comments...

PBIL Back to PBIL home page