(data stored in ACNUC7421 zone)

EMBL: CP000272.PE246

CP000272.PE246       Location/Qualifiers
FT   CDS             273002..273751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0250"
FT                   /product="Electron transfer flavoprotein beta-subunit,
FT                   EtfB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36174"
FT                   /db_xref="GOA:Q13IB5"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB5"
FT                   /protein_id="ABE36174.1"
FT                   /translation="MKVVVAVKRVVDYNVKVRVKADGTGVDIANVKMSMNPFDEIAVEE
FT                   AVRLKEAGVATEVIAVSAGVTQAQETLRTALAIGADRAILIESNEELQPLAVAKLLKAL
FT                   VDREQPSLVILGKQAIDDDSNQTGQMLAALANLPQATFASKVVVADGKATVSREVDGGA
FT                   ETLSLTLPAVVTTDLRLNEPRYVTLPNIMKAKKKPLEVVKPEDLGVDVTPRLKTLKVVE
FT                   PPKRPAGVKVPDVQTLVGKLKTEARVL"
     MKVVVAVKRV VDYNVKVRVK ADGTGVDIAN VKMSMNPFDE IAVEEAVRLK EAGVATEVIA        60
     VSAGVTQAQE TLRTALAIGA DRAILIESNE ELQPLAVAKL LKALVDREQP SLVILGKQAI       120
     DDDSNQTGQM LAALANLPQA TFASKVVVAD GKATVSREVD GGAETLSLTL PAVVTTDLRL       180
     NEPRYVTLPN IMKAKKKPLE VVKPEDLGVD VTPRLKTLKV VEPPKRPAGV KVPDVQTLVG       240
     KLKTEARVL                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page