(data stored in SCRATCH zone)

EMBL: CP000272.PE247

CP000272.PE247       Location/Qualifiers
FT   CDS             273869..274852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0251"
FT                   /product="Electron transfer flavoprotein, alpha subunit,
FT                   EtfA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36175"
FT                   /db_xref="GOA:Q13IB4"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB4"
FT                   /protein_id="ABE36175.1"
FT                   /translation="MTILVIAEHDAPKEAPLGGNASLKAATLNTVAAAAVIATLAAHDI
FT                   HVLVAGHNAQGAAEEAAKIAGVTKVLLADAPQLEAGLAENVAATVLNIAKDYSHILAPA
FT                   TAYGKNIAPRIAAKLDVAQISDITAVDSADTFERPIYAGNAIATVQSQDPIKVITVRTT
FT                   GFDAVAAEGGSATVGKIEAAADAGVSQFVSREVTKLDRPELTSAKIIVSGGRGLGNGEN
FT                   YTKVLEPLADRLNAALGASRAAVDAGFVPNDYQVGQTGKIVAPQLYIAVGISGAIQHLA
FT                   GMKDSKVIVAINKDEEAPIFSVADYGVVGDLFTVVPEFASQLAQLD"
     MTILVIAEHD APKEAPLGGN ASLKAATLNT VAAAAVIATL AAHDIHVLVA GHNAQGAAEE        60
     AAKIAGVTKV LLADAPQLEA GLAENVAATV LNIAKDYSHI LAPATAYGKN IAPRIAAKLD       120
     VAQISDITAV DSADTFERPI YAGNAIATVQ SQDPIKVITV RTTGFDAVAA EGGSATVGKI       180
     EAAADAGVSQ FVSREVTKLD RPELTSAKII VSGGRGLGNG ENYTKVLEPL ADRLNAALGA       240
     SRAAVDAGFV PNDYQVGQTG KIVAPQLYIA VGISGAIQHL AGMKDSKVIV AINKDEEAPI       300
     FSVADYGVVG DLFTVVPEFA SQLAQLD                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page