(data stored in ACNUC7421 zone)

EMBL: CP000272.PE25

CP000272.PE25        Location/Qualifiers
FT   CDS             33148..33414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35953"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY6"
FT                   /protein_id="ABE35953.1"
FT                   /translation="MATRTMGADRFAATLSWLERGAVRGVRWDRRIPADRISRNPVAEK
FT                   AKVSVAANGAPSAQERAAIGLVRELAGRYRETADAASTGPRWP"
     MATRTMGADR FAATLSWLER GAVRGVRWDR RIPADRISRN PVAEKAKVSV AANGAPSAQE        60
     RAAIGLVREL AGRYRETADA ASTGPRWP                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page