(data stored in ACNUC7421 zone)

EMBL: CP000272.PE250

CP000272.PE250       Location/Qualifiers
FT   CDS             276885..277160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36178"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB1"
FT                   /protein_id="ABE36178.1"
FT                   /translation="MLVSRSPSMHGIGHAASGREAPRKLHPLRRYLYAGNFRVGLPAVL
FT                   CQDIGLVDGMGRRAESSAMVVSGVPAGNAGLVRASQTPSTVRIRYS"
     MLVSRSPSMH GIGHAASGRE APRKLHPLRR YLYAGNFRVG LPAVLCQDIG LVDGMGRRAE        60
     SSAMVVSGVP AGNAGLVRAS QTPSTVRIRY S                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page