(data stored in ACNUC7421 zone)

EMBL: CP000272.PE251

CP000272.PE251       Location/Qualifiers
FT   CDS             complement(277155..277682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36179"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB0"
FT                   /protein_id="ABE36179.1"
FT                   /translation="MAYRQRHRISARRNSEMHGEHTDTWSQTVALLDHGLAHQMMDTLA
FT                   RIAAAHPQKTAWSHHPALTVRVIERTSARTVSVSWCDPLSGYYGYQSWHASLARRRASC
FT                   VLSGEPISRGDPVYQPSSRPSRPGNAGAMILASRVDAALRVDHQPAGHEVAAGATGRTD
FT                   GAGCCGLQEGAL"
     MAYRQRHRIS ARRNSEMHGE HTDTWSQTVA LLDHGLAHQM MDTLARIAAA HPQKTAWSHH        60
     PALTVRVIER TSARTVSVSW CDPLSGYYGY QSWHASLARR RASCVLSGEP ISRGDPVYQP       120
     SSRPSRPGNA GAMILASRVD AALRVDHQPA GHEVAAGATG RTDGAGCCGL QEGAL            175
//

If you have problems or comments...

PBIL Back to PBIL home page