(data stored in ACNUC7421 zone)

EMBL: CP000272.PE252

CP000272.PE252       Location/Qualifiers
FT   CDS             278072..278467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36180"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA9"
FT                   /protein_id="ABE36180.1"
FT                   /translation="MLDAGTSGKPERQEAAFMINSPRAILRKRVAIALMAATTAMSAIP
FT                   AMAQHDRHGGGGHGGGYHGGGYRGGYHGGGYDRGGHGGGGGLIVGALLGAVAAAAVTSA
FT                   VQAPPAVTYAEPPPPPPPGVAYYPPGY"
     MLDAGTSGKP ERQEAAFMIN SPRAILRKRV AIALMAATTA MSAIPAMAQH DRHGGGGHGG        60
     GYHGGGYRGG YHGGGYDRGG HGGGGGLIVG ALLGAVAAAA VTSAVQAPPA VTYAEPPPPP       120
     PPGVAYYPPG Y                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page