(data stored in SCRATCH zone)

EMBL: CP000272.PE255

CP000272.PE255       Location/Qualifiers
FT   CDS             complement(281448..282035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0259"
FT                   /product="isochorismatase hydrolase family protein"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36183"
FT                   /db_xref="GOA:Q13IA6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA6"
FT                   /protein_id="ABE36183.1"
FT                   /translation="MMTQPLSIDRKRAALLVMDFQKLIIDGYATESEPLLSRTATLLEA
FT                   TRDAGIMVIYVVVGFRPGYPEVSERNMTFSAIRTSGRFATDDASIEVHPAVAPRAAETV
FT                   VTKHRVSAFAGTDLDMILRANSIDTLLLTGIATSGVVLSTLRHAADADYRVFVVGDCCS
FT                   DSDAEVHRVLLDKIFPRQAVVSEASTIIAGLA"
     MMTQPLSIDR KRAALLVMDF QKLIIDGYAT ESEPLLSRTA TLLEATRDAG IMVIYVVVGF        60
     RPGYPEVSER NMTFSAIRTS GRFATDDASI EVHPAVAPRA AETVVTKHRV SAFAGTDLDM       120
     ILRANSIDTL LLTGIATSGV VLSTLRHAAD ADYRVFVVGD CCSDSDAEVH RVLLDKIFPR       180
     QAVVSEASTI IAGLA                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page