(data stored in ACNUC7421 zone)

EMBL: CP000272.PE257

CP000272.PE257       Location/Qualifiers
FT   CDS             complement(283174..284715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0261"
FT                   /product="Putative radical SAM domain/B12 binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36185"
FT                   /db_xref="GOA:Q13IA4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027564"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA4"
FT                   /protein_id="ABE36185.1"
FT                   /translation="MKVLTVHPSGLMYTRVFLRLEPLGLETVAAVLREAGHEVRLIDLQ
FT                   VETHRDLHRLIRNWQPDAVCFSGNYLANIPEIVDLAKSVKEKQPRCFVFVGGHSVSFTA
FT                   ADILRHAEGAVDCVLKGEGEASVVALLEAASHGADLLQIPGAVTQHGEGPPPHFVESLD
FT                   PVRPARDLLRHRRKYFIGTLDPCASIEFARGCPWDCTFCSAWTFYGRSYRARSPEVVAG
FT                   ELASIREPGVFIVDDVAFVHADHGMEIGKAVQRRGIRKKYYLETRGDVLLRNREVFEFW
FT                   RGLGLQYMFIGMEAIDAEGLKAFRKRINLDRNFEALAFARSLGITVAINLIADPDWDHD
FT                   RFEAVRQWCLEIPEIVNISVNTPYPGTEIWLREQRRLTSLDYRLYDIQHAVLPTRLPLP
FT                   EFYAELVRTQQVLNRKHLGWTALRGAAGHACHLLLRGQTNFVRMLWRFNSVFNPQLQLN
FT                   DHAREVHYTMSPPPGITEQRIDVKALYVHGPIGRKGRRIDDATENFVEQTRMGAG"
     MKVLTVHPSG LMYTRVFLRL EPLGLETVAA VLREAGHEVR LIDLQVETHR DLHRLIRNWQ        60
     PDAVCFSGNY LANIPEIVDL AKSVKEKQPR CFVFVGGHSV SFTAADILRH AEGAVDCVLK       120
     GEGEASVVAL LEAASHGADL LQIPGAVTQH GEGPPPHFVE SLDPVRPARD LLRHRRKYFI       180
     GTLDPCASIE FARGCPWDCT FCSAWTFYGR SYRARSPEVV AGELASIREP GVFIVDDVAF       240
     VHADHGMEIG KAVQRRGIRK KYYLETRGDV LLRNREVFEF WRGLGLQYMF IGMEAIDAEG       300
     LKAFRKRINL DRNFEALAFA RSLGITVAIN LIADPDWDHD RFEAVRQWCL EIPEIVNISV       360
     NTPYPGTEIW LREQRRLTSL DYRLYDIQHA VLPTRLPLPE FYAELVRTQQ VLNRKHLGWT       420
     ALRGAAGHAC HLLLRGQTNF VRMLWRFNSV FNPQLQLNDH AREVHYTMSP PPGITEQRID       480
     VKALYVHGPI GRKGRRIDDA TENFVEQTRM GAG                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page