(data stored in ACNUC7421 zone)

EMBL: CP000272.PE26

CP000272.PE26        Location/Qualifiers
FT   CDS             33416..34015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35954"
FT                   /db_xref="GOA:Q13IY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY5"
FT                   /protein_id="ABE35954.1"
FT                   /translation="MARTDLAVLAGVAILALACLVVCSMYVYWSSDRYRDRQRRLEPQA
FT                   TGTPTRARATGRNDARFSGVGATMGTQLSHRCKTSLYRAVLGGARHESIAFLMADSRDD
FT                   ARTRAISAVAAIHGIAPRDVPLCKLASFRELIDIGVSEDEELRIFEMAWKGMDVSGWAE
FT                   HPLFLTDDPSLLGKWAELYADLARQLATSAIDRARG"
     MARTDLAVLA GVAILALACL VVCSMYVYWS SDRYRDRQRR LEPQATGTPT RARATGRNDA        60
     RFSGVGATMG TQLSHRCKTS LYRAVLGGAR HESIAFLMAD SRDDARTRAI SAVAAIHGIA       120
     PRDVPLCKLA SFRELIDIGV SEDEELRIFE MAWKGMDVSG WAEHPLFLTD DPSLLGKWAE       180
     LYADLARQLA TSAIDRARG                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page