(data stored in SCRATCH zone)

EMBL: CP000272.PE284

CP000272.PE284       Location/Qualifiers
FT   CDS             315695..316645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0289"
FT                   /product="Putative iron-sulfur oxidoreductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36212"
FT                   /db_xref="GOA:Q13I77"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I77"
FT                   /protein_id="ABE36212.1"
FT                   /translation="MDKAQEINLVVRAITQEADGVIGLTLAAADGQDLPVWTPGAHIGL
FT                   LVDGGLERQYSLCSEPEDRRQWRIAVLREPESRGGSAWLHSRLQVGDILRATGPGNQFE
FT                   LVDADRYVFVAGGIGITPLLPMIRAVEARGAQWSLLYGGRHRSSMAFAAALEAYGERVR
FT                   IQPEDQCGLLDLKAALGAPQAGVAIYSCGPERLLEAVEATCVGWPEGALHVERFRPRPG
FT                   ALEGESGSFEVVLAKSNLSCQVREGQTIIDALDTAGFHVPRSCGEGTCGTCVAKVLEGV
FT                   PDHRDSFLMGKKRAANQTICVCCSRSLTPRLVLDL"
     MDKAQEINLV VRAITQEADG VIGLTLAAAD GQDLPVWTPG AHIGLLVDGG LERQYSLCSE        60
     PEDRRQWRIA VLREPESRGG SAWLHSRLQV GDILRATGPG NQFELVDADR YVFVAGGIGI       120
     TPLLPMIRAV EARGAQWSLL YGGRHRSSMA FAAALEAYGE RVRIQPEDQC GLLDLKAALG       180
     APQAGVAIYS CGPERLLEAV EATCVGWPEG ALHVERFRPR PGALEGESGS FEVVLAKSNL       240
     SCQVREGQTI IDALDTAGFH VPRSCGEGTC GTCVAKVLEG VPDHRDSFLM GKKRAANQTI       300
     CVCCSRSLTP RLVLDL                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page