(data stored in SCRATCH zone)

EMBL: CP000272.PE3

CP000272.PE3         Location/Qualifiers
FT   CDS             complement(2190..2561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35931"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J08"
FT                   /protein_id="ABE35931.1"
FT                   /translation="MAISIFIGPPIRPTVPPASRREQGAWQAHPGGHGIRLQVGTVDEI
FT                   RLFRSGSGHLGPGCFSYGKQARNFWLIPIPWLPKATPAAIGAKAAFAFPLPRTFERPFC
FT                   QEKAILRHAISGWRTGNAR"
     MAISIFIGPP IRPTVPPASR REQGAWQAHP GGHGIRLQVG TVDEIRLFRS GSGHLGPGCF        60
     SYGKQARNFW LIPIPWLPKA TPAAIGAKAA FAFPLPRTFE RPFCQEKAIL RHAISGWRTG       120
     NAR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page