(data stored in ACNUC7421 zone)

EMBL: CP000272.PE305

CP000272.PE305       Location/Qualifiers
FT   CDS             complement(344115..344786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36233"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I56"
FT                   /protein_id="ABE36233.1"
FT                   /translation="MIPDSTLSIHEISAFVDAGIPPDTPPGEHLDPLTVEFIEYALRSS
FT                   VTTLDTQDAEQHAQRALSLGATTAQLHEILLLVSALGVHSLMAGSTKLARLGSPAGKPM
FT                   TLAPLTNEQQALHQKYVGESSYWRRFEEAIPGFLDSLLRFSPEGFEAFFNFCALPWHKA
FT                   TVPALTKELISIAVDATPSHRFLPGVRIHVGNALTLGCGRTALREVLAIAARAPVHSGV
FT                   R"
     MIPDSTLSIH EISAFVDAGI PPDTPPGEHL DPLTVEFIEY ALRSSVTTLD TQDAEQHAQR        60
     ALSLGATTAQ LHEILLLVSA LGVHSLMAGS TKLARLGSPA GKPMTLAPLT NEQQALHQKY       120
     VGESSYWRRF EEAIPGFLDS LLRFSPEGFE AFFNFCALPW HKATVPALTK ELISIAVDAT       180
     PSHRFLPGVR IHVGNALTLG CGRTALREVL AIAARAPVHS GVR                         223
//

If you have problems or comments...

PBIL Back to PBIL home page