(data stored in ACNUC7421 zone)

EMBL: CP000272.PE325

CP000272.PE325       Location/Qualifiers
FT   CDS             complement(369187..371586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36253"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I36"
FT                   /protein_id="ABE36253.1"
FT                   /translation="MNEDHQNIEAKAAALRSRLGPHIAPRGLYERHKALPFAGRVTCNV
FT                   NRLEAGSWSEIMLDYEVGASGVADGAWLKATFKFYSDWALFQTSDPSAANFISAEYHAA
FT                   PLVPGQSPATVQSLNVRFDQKGHERPFQKAIIVDVADGYLNAGDHIVIRLGDRRRGPGT
FT                   RVQTFVEDQFRFRFYIDPLGTSRFVAVPGDIVIDIHAGAPSQVLLNGPRFVQPGQRAPF
FT                   RVSLQDRWSNACKDIDGGVRVRAYDERSEIVYERELALPRDAWATVALDDLPTASGTLR
FT                   IVADVPSKGDVRAAEVFLTVDATLPVARSLYADLHVHAHDTVGTNSPAYNAAYARDIGG
FT                   IDVLGYTANDFQITDANWQLGIETAEQFNQAGRFVVYPVQEWCGSSTAGGDHNVVFLGD
FT                   ERPGFPYNARGEHNRTLVWNEDMKGTAVDLGRWPVDELWDAYVDDAANHLVMPHVGGRR
FT                   YIPDWHHPELERLVEIASTWGHFDWLYRDVISRGYKLGVAASGDEHRGRPGGGAPGVSV
FT                   FGVHGGLTGVLSDSLDRHSVGRALRARHTWATTGEHSAALVRCGEYQQGDEFNHSGPAT
FT                   LDYRLLGRAGWEYVAAFDHDGLLVERNLHEELGYAERLIRVRWGGARIRDRYRWAAWRG
FT                   RIRIINGTINNFGAGGFEHIEEAAWRTGATDIEFSSDTYGDADNIEIDVSNLARARIVI
FT                   EGTIDGFVKVGDPLKGNPFVHSPMFHWEISGADLLAQGTARHELGGTELFLAVERLTDK
FT                   PLPVDLSGSFDVSAQNAAFGFRPVYVFGRQRDDSKVWTSAQFITFD"
     MNEDHQNIEA KAAALRSRLG PHIAPRGLYE RHKALPFAGR VTCNVNRLEA GSWSEIMLDY        60
     EVGASGVADG AWLKATFKFY SDWALFQTSD PSAANFISAE YHAAPLVPGQ SPATVQSLNV       120
     RFDQKGHERP FQKAIIVDVA DGYLNAGDHI VIRLGDRRRG PGTRVQTFVE DQFRFRFYID       180
     PLGTSRFVAV PGDIVIDIHA GAPSQVLLNG PRFVQPGQRA PFRVSLQDRW SNACKDIDGG       240
     VRVRAYDERS EIVYERELAL PRDAWATVAL DDLPTASGTL RIVADVPSKG DVRAAEVFLT       300
     VDATLPVARS LYADLHVHAH DTVGTNSPAY NAAYARDIGG IDVLGYTAND FQITDANWQL       360
     GIETAEQFNQ AGRFVVYPVQ EWCGSSTAGG DHNVVFLGDE RPGFPYNARG EHNRTLVWNE       420
     DMKGTAVDLG RWPVDELWDA YVDDAANHLV MPHVGGRRYI PDWHHPELER LVEIASTWGH       480
     FDWLYRDVIS RGYKLGVAAS GDEHRGRPGG GAPGVSVFGV HGGLTGVLSD SLDRHSVGRA       540
     LRARHTWATT GEHSAALVRC GEYQQGDEFN HSGPATLDYR LLGRAGWEYV AAFDHDGLLV       600
     ERNLHEELGY AERLIRVRWG GARIRDRYRW AAWRGRIRII NGTINNFGAG GFEHIEEAAW       660
     RTGATDIEFS SDTYGDADNI EIDVSNLARA RIVIEGTIDG FVKVGDPLKG NPFVHSPMFH       720
     WEISGADLLA QGTARHELGG TELFLAVERL TDKPLPVDLS GSFDVSAQNA AFGFRPVYVF       780
     GRQRDDSKVW TSAQFITFD                                                    799
//

If you have problems or comments...

PBIL Back to PBIL home page