(data stored in ACNUC7421 zone)

EMBL: CP000272.PE328

CP000272.PE328       Location/Qualifiers
FT   CDS             complement(374194..374535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36256"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I33"
FT                   /protein_id="ABE36256.1"
FT                   /translation="MSQVHSLPSSSSWHRRQDIISYQYSLLSIGSFWQTLPFRETCHTG
FT                   PQLRGHPIAYNLRMPDVAPPRPFPDTAPLSALRAWYAGVGSRQAVERYCPQALEGGQPA
FT                   CGFADKAPA"
     MSQVHSLPSS SSWHRRQDII SYQYSLLSIG SFWQTLPFRE TCHTGPQLRG HPIAYNLRMP        60
     DVAPPRPFPD TAPLSALRAW YAGVGSRQAV ERYCPQALEG GQPACGFADK APA              113
//

If you have problems or comments...

PBIL Back to PBIL home page