(data stored in ACNUC7421 zone)

EMBL: CP000272.PE33

CP000272.PE33        Location/Qualifiers
FT   CDS             40953..42155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0034"
FT                   /product="Putative carbon monoxide dehydrogenase, CoxE
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35961"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX8"
FT                   /protein_id="ABE35961.1"
FT                   /translation="MLTGIDGAAAPRPQPSGLEEALTARYAGFAGWLRANDFQVTGSDV
FT                   AASMEVALRMGQLDSQVLRWSLRALLCSRAQEWRRFDELFDAYFFAPNRRKQVETRAGG
FT                   AGRIEPDPAAGQRDGSEGAPLSPASGGGAAPPDGSTAEQGACGEASLAQADFRHLNQPD
FT                   ELFAIDTAIRRFAQRLQGIQLRSERRANAGSVIDMAWTVRRSVSRGGLPLELGWRRKRR
FT                   LRPRIVLLLDVSRSMSLYSFFYLRLARVLSARVSDVHCFIFHTRLVAIEQALRDPDPWR
FT                   SQERLQLLSAGWAGGTRIGDSLDEFNRQQATRLLHSRTAVVVVSDGYDAGEPERLQQAL
FT                   ATMRRRCRCVVWLNPLASRADFAPASAGMQAALPYIDLLAGARDLASLERVLPQVLSVL
FT                   Q"
     MLTGIDGAAA PRPQPSGLEE ALTARYAGFA GWLRANDFQV TGSDVAASME VALRMGQLDS        60
     QVLRWSLRAL LCSRAQEWRR FDELFDAYFF APNRRKQVET RAGGAGRIEP DPAAGQRDGS       120
     EGAPLSPASG GGAAPPDGST AEQGACGEAS LAQADFRHLN QPDELFAIDT AIRRFAQRLQ       180
     GIQLRSERRA NAGSVIDMAW TVRRSVSRGG LPLELGWRRK RRLRPRIVLL LDVSRSMSLY       240
     SFFYLRLARV LSARVSDVHC FIFHTRLVAI EQALRDPDPW RSQERLQLLS AGWAGGTRIG       300
     DSLDEFNRQQ ATRLLHSRTA VVVVSDGYDA GEPERLQQAL ATMRRRCRCV VWLNPLASRA       360
     DFAPASAGMQ AALPYIDLLA GARDLASLER VLPQVLSVLQ                             400
//

If you have problems or comments...

PBIL Back to PBIL home page