(data stored in ACNUC7421 zone)

EMBL: CP000272.PE330

CP000272.PE330       Location/Qualifiers
FT   CDS             complement(376062..376628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0346"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36258"
FT                   /db_xref="GOA:Q13I31"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I31"
FT                   /protein_id="ABE36258.1"
FT                   /translation="MQKRKICQQHNILRLAAVLALAATSISARADGFGVQLAAGVADHD
FT                   VKKGDLGIVWDPGLKWWEIGGYHFTVVGEAHAAYWAVREDHATHPDIWEFGLTPVLRFV
FT                   RSSGWFRPYIEAGVGVRLLSHVRETQDRTFSSSFQFADMVGVGAQFGDHQNYQAGFRFQ
FT                   HLSNAGLEHPNPGINFSEIYVQYNF"
     MQKRKICQQH NILRLAAVLA LAATSISARA DGFGVQLAAG VADHDVKKGD LGIVWDPGLK        60
     WWEIGGYHFT VVGEAHAAYW AVREDHATHP DIWEFGLTPV LRFVRSSGWF RPYIEAGVGV       120
     RLLSHVRETQ DRTFSSSFQF ADMVGVGAQF GDHQNYQAGF RFQHLSNAGL EHPNPGINFS       180
     EIYVQYNF                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page