(data stored in ACNUC7421 zone)

EMBL: CP000272.PE331

CP000272.PE331       Location/Qualifiers
FT   CDS             complement(376738..377637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0347"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36259"
FT                   /db_xref="GOA:Q13I30"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I30"
FT                   /protein_id="ABE36259.1"
FT                   /translation="MRWLVLLLFAVSAAWTHSRGKVRHGFFRQLSDHSTFTAPLNGFVY
FT                   LFSALPAQPYLPPSRFPELKLLKEEWRTIRDEAFALRDASHIRAATAYNDIGFNSFFRN
FT                   GWRRFYLKWYGRPHPSAVALCPRTVELLGRIPSVKAAMFAQLPPGGRLGLHRDPYAGAL
FT                   RYHLGLATPNHDGCAIVVDGETYSWRDGEDIVFDETYLHYAFNDTQEDRIILFCDIERP
FT                   MKYRWARAINRAIGSFLMRAAASPNETGDYTGGLNRIFRYLYMVRRAGKRLKAWNRTVY
FT                   YVVKWCLFIAIALAIFWR"
     MRWLVLLLFA VSAAWTHSRG KVRHGFFRQL SDHSTFTAPL NGFVYLFSAL PAQPYLPPSR        60
     FPELKLLKEE WRTIRDEAFA LRDASHIRAA TAYNDIGFNS FFRNGWRRFY LKWYGRPHPS       120
     AVALCPRTVE LLGRIPSVKA AMFAQLPPGG RLGLHRDPYA GALRYHLGLA TPNHDGCAIV       180
     VDGETYSWRD GEDIVFDETY LHYAFNDTQE DRIILFCDIE RPMKYRWARA INRAIGSFLM       240
     RAAASPNETG DYTGGLNRIF RYLYMVRRAG KRLKAWNRTV YYVVKWCLFI AIALAIFWR        299
//

If you have problems or comments...

PBIL Back to PBIL home page