(data stored in SCRATCH zone)

EMBL: CP000272.PE335

CP000272.PE335       Location/Qualifiers
FT   CDS             complement(380633..381058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0351"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36263"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I26"
FT                   /protein_id="ABE36263.1"
FT                   /translation="MSSVQTEIPLDPNSRPHWEAATRGVLLVQRCTDCGTHRFPAAWQC
FT                   AHCHGRNAEWVALSGLGRIESFCTFHKAYWPSVRDQLPYTVVQVMLDEGVRYMSSMAGN
FT                   PGPQMQIGLRVRAWFDPVSPTLTLIRFAPADAPAPRS"
     MSSVQTEIPL DPNSRPHWEA ATRGVLLVQR CTDCGTHRFP AAWQCAHCHG RNAEWVALSG        60
     LGRIESFCTF HKAYWPSVRD QLPYTVVQVM LDEGVRYMSS MAGNPGPQMQ IGLRVRAWFD       120
     PVSPTLTLIR FAPADAPAPR S                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page