(data stored in SCRATCH zone)

EMBL: CP000272.PE336

CP000272.PE336       Location/Qualifiers
FT   CDS             complement(381055..382215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0352"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36264"
FT                   /db_xref="GOA:Q13I25"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I25"
FT                   /protein_id="ABE36264.1"
FT                   /translation="MLSKLQNEPAVAGVGTTRYGKLPGHDIYELAQWALREALDDCGLT
FT                   HADLDGLIVNRIPSYSHFADQCGMNPQYVLATPGHGRFSGICIQTAALLVSSGAVNTVA
FT                   LVYANDGGSAGITYGGDASQFGGAAGAYGGADSHWVPYGMTSPGAFHALMMQRHMHLHG
FT                   TTASQLAEVAMTFRHHASLNPAAVKRDPFTLEQYLESRFICDPLRLLDYCLINDGAVAM
FT                   IITNGSRARDLRKPPVYIRGVGQASQFTGGGFPPDDFWARPMRQVAQEVHSMAGTTVND
FT                   MDGLMIYDNFTPTVLFSLEGFGFCPTGESGRWVSEGHLRLGGRFPANTSGGHLSESYLQ
FT                   GWGLNAEAVRQLRGECDARQIAGADFIQYMAASPVVTSIIYGKDPK"
     MLSKLQNEPA VAGVGTTRYG KLPGHDIYEL AQWALREALD DCGLTHADLD GLIVNRIPSY        60
     SHFADQCGMN PQYVLATPGH GRFSGICIQT AALLVSSGAV NTVALVYAND GGSAGITYGG       120
     DASQFGGAAG AYGGADSHWV PYGMTSPGAF HALMMQRHMH LHGTTASQLA EVAMTFRHHA       180
     SLNPAAVKRD PFTLEQYLES RFICDPLRLL DYCLINDGAV AMIITNGSRA RDLRKPPVYI       240
     RGVGQASQFT GGGFPPDDFW ARPMRQVAQE VHSMAGTTVN DMDGLMIYDN FTPTVLFSLE       300
     GFGFCPTGES GRWVSEGHLR LGGRFPANTS GGHLSESYLQ GWGLNAEAVR QLRGECDARQ       360
     IAGADFIQYM AASPVVTSII YGKDPK                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page