(data stored in ACNUC7421 zone)

EMBL: CP000272.PE34

CP000272.PE34        Location/Qualifiers
FT   CDS             42166..43206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0035"
FT                   /product="Putative carbon monoxide dehydrogenase, CoxF
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35962"
FT                   /db_xref="GOA:Q13IX7"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX7"
FT                   /protein_id="ABE35962.1"
FT                   /translation="MNDETLLQLEQRLIEEARPFAVVTVIRAAPPTSAWVGAQALVESD
FT                   GALHGWIGGGCSRAIVIEAAQQTLRAGLPKRVRISNEPGRPEADVEAHAMPCASNGTLE
FT                   LFIQPTLPAPAVLVLGSTPTALEACELAQRVGLRVSAAANVTAPFAALGLSRVVQGFDV
FT                   AVFEQIKPRLILVATQGDGDEDALEAALRSPAAAVLLVASQRKAERLRDAMRVRGIAPE
FT                   RLAALHAPAGPHIHAHTPQEIALGAVAGLVTLRRELEQATAADADARHLVSGEAVAALP
FT                   PCEAPSARYLNPVCGMAVEIASAKHVLDYGGQRIYFCCDCCKLEFERRPGKYLAIAQRK
FT                   AQLENT"
     MNDETLLQLE QRLIEEARPF AVVTVIRAAP PTSAWVGAQA LVESDGALHG WIGGGCSRAI        60
     VIEAAQQTLR AGLPKRVRIS NEPGRPEADV EAHAMPCASN GTLELFIQPT LPAPAVLVLG       120
     STPTALEACE LAQRVGLRVS AAANVTAPFA ALGLSRVVQG FDVAVFEQIK PRLILVATQG       180
     DGDEDALEAA LRSPAAAVLL VASQRKAERL RDAMRVRGIA PERLAALHAP AGPHIHAHTP       240
     QEIALGAVAG LVTLRRELEQ ATAADADARH LVSGEAVAAL PPCEAPSARY LNPVCGMAVE       300
     IASAKHVLDY GGQRIYFCCD CCKLEFERRP GKYLAIAQRK AQLENT                      346
//

If you have problems or comments...

PBIL Back to PBIL home page