(data stored in ACNUC7421 zone)

EMBL: CP000272.PE349

CP000272.PE349       Location/Qualifiers
FT   CDS             395808..396494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0370"
FT                   /product="ABC heme exporter, ATPase subunit CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36277"
FT                   /db_xref="GOA:Q13I12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13I12"
FT                   /protein_id="ABE36277.1"
FT                   /translation="MLSIERLGVGRGGQMVASGIDLCIEAGWALQIHGANGSGKTTLLR
FT                   VLAGLMPPAGGQVSWYGANVRAHPEKFRRDLAFVGHANGVNDDLTVLENLRFATLLGAG
FT                   SGAPDGTSSVPASGRSGVAAPPSRRDMLARAGMLPLQHTRAGCLSQGQRRRVALARLML
FT                   DRKPLWLLDEPGDALDDSASGWLHECLALHMQDGGIVVATTHRSLQTPAARTRHLHLER
FT                   SGAWLD"
     MLSIERLGVG RGGQMVASGI DLCIEAGWAL QIHGANGSGK TTLLRVLAGL MPPAGGQVSW        60
     YGANVRAHPE KFRRDLAFVG HANGVNDDLT VLENLRFATL LGAGSGAPDG TSSVPASGRS       120
     GVAAPPSRRD MLARAGMLPL QHTRAGCLSQ GQRRRVALAR LMLDRKPLWL LDEPGDALDD       180
     SASGWLHECL ALHMQDGGIV VATTHRSLQT PAARTRHLHL ERSGAWLD                    228
//

If you have problems or comments...

PBIL Back to PBIL home page