(data stored in SCRATCH zone)

EMBL: CP000272.PE350

CP000272.PE350       Location/Qualifiers
FT   CDS             396482..397150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0371"
FT                   /product="ABC heme exporter, inner membrane subunit CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36278"
FT                   /db_xref="GOA:Q13I11"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I11"
FT                   /protein_id="ABE36278.1"
FT                   /translation="MAGLTLGVIRRELALTWRRRTVTLGSLMFFVIASSLFPLAVGPDP
FT                   KLLQAIAPGVLWVTALLAAMLSAGHLFAQDFASGTLEQMLLSPWPLPGIVFGKIVAHWL
FT                   TGGLAQVLLAPVVALQYELGWRATLPLMGSLLLGTPLLSLIGSMGAALTLGVRGGGVTL
FT                   ALVILPLYVPVLIFGVSASDPGTSAAWSKANFSLLGAALCAAGLLCPWASAVALRIALE
FT                   "
     MAGLTLGVIR RELALTWRRR TVTLGSLMFF VIASSLFPLA VGPDPKLLQA IAPGVLWVTA        60
     LLAAMLSAGH LFAQDFASGT LEQMLLSPWP LPGIVFGKIV AHWLTGGLAQ VLLAPVVALQ       120
     YELGWRATLP LMGSLLLGTP LLSLIGSMGA ALTLGVRGGG VTLALVILPL YVPVLIFGVS       180
     ASDPGTSAAW SKANFSLLGA ALCAAGLLCP WASAVALRIA LE                          222
//

If you have problems or comments...

PBIL Back to PBIL home page