(data stored in SCRATCH zone)

EMBL: CP000272.PE351

CP000272.PE351       Location/Qualifiers
FT   CDS             397154..397903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0372"
FT                   /product="ABC heme exporter, inner membrane subunit CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36279"
FT                   /db_xref="GOA:Q13I10"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I10"
FT                   /protein_id="ABE36279.1"
FT                   /translation="MHMTRINWFHYASPRVFDGLAARLAPCFAVVSGVLILAGLAIGLV
FT                   IAPTDALQGDVYRIMFVHVPAAWMSMFIYVVMAMYCALGLVFNARLAAMMALALAPTGA
FT                   LFTFIALLSGALWGKPTWGAWWVWDARLSSELILLFLYIGFISLHAAIDEPRRADRACA
FT                   VLGLIGVVNIPVIYFSVQWWYTLHQGPSLGFGSGVSMSESMVWGIVVMSFGFWAYSIAV
FT                   TFVRVRVIIRTRERTSPWEARLEERPA"
     MHMTRINWFH YASPRVFDGL AARLAPCFAV VSGVLILAGL AIGLVIAPTD ALQGDVYRIM        60
     FVHVPAAWMS MFIYVVMAMY CALGLVFNAR LAAMMALALA PTGALFTFIA LLSGALWGKP       120
     TWGAWWVWDA RLSSELILLF LYIGFISLHA AIDEPRRADR ACAVLGLIGV VNIPVIYFSV       180
     QWWYTLHQGP SLGFGSGVSM SESMVWGIVV MSFGFWAYSI AVTFVRVRVI IRTRERTSPW       240
     EARLEERPA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page