(data stored in ACNUC7421 zone)

EMBL: CP000272.PE358

CP000272.PE358       Location/Qualifiers
FT   CDS             complement(403077..403352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36286"
FT                   /db_xref="GOA:Q13I03"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I03"
FT                   /protein_id="ABE36286.1"
FT                   /translation="MATQSKRGISRSCLHEGKNITKRFEMTLFNIAMNVYALIHATRHL
FT                   VEFCRRELMFHFFAHVGILLIRFPVWPARPARAFFLHGDNQIGVLR"
     MATQSKRGIS RSCLHEGKNI TKRFEMTLFN IAMNVYALIH ATRHLVEFCR RELMFHFFAH        60
     VGILLIRFPV WPARPARAFF LHGDNQIGVL R                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page