(data stored in SCRATCH zone)

EMBL: CP000272.PE36

CP000272.PE36        Location/Qualifiers
FT   CDS             complement(43906..44289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0037"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35964"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX5"
FT                   /protein_id="ABE35964.1"
FT                   /translation="MPSAVRNSLLWIFDAFERDSTYLCKRMFGCDAAYIDGLLCLVAAD
FT                   RGEPWNGLLVCTSQERHAALIAEMPALRPHPVLGKWLYVAQDDPAFEVVVARMTALVLA
FT                   RDPRVGVEPKPRKHRGKATLPNT"
     MPSAVRNSLL WIFDAFERDS TYLCKRMFGC DAAYIDGLLC LVAADRGEPW NGLLVCTSQE        60
     RHAALIAEMP ALRPHPVLGK WLYVAQDDPA FEVVVARMTA LVLARDPRVG VEPKPRKHRG       120
     KATLPNT                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page