(data stored in ACNUC7421 zone)

EMBL: CP000272.PE360

CP000272.PE360       Location/Qualifiers
FT   CDS             404182..404877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0381"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36288"
FT                   /db_xref="GOA:Q13I01"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I01"
FT                   /protein_id="ABE36288.1"
FT                   /translation="MSTEVISRSGRLAGRPPRYGNRQRNPVRRYAGIAVVVLLHILFIW
FT                   ALMNGLANKVVQIVQKPIETKIIEPVKPPPPPPMPTVQLPPPKFTPPPPPFVPPPEVAV
FT                   TPPPARAPTITHQAVPIPTPVAPPPPAPVAPPAPAKPVSHAVGVVCPNSDEVRRSVGYP
FT                   QEAQDNDISGDVMISFVVDPQGHVTDEKVEQSADPILDRAAFSAVKKFNCISQGQPVRV
FT                   QVPFSFKLN"
     MSTEVISRSG RLAGRPPRYG NRQRNPVRRY AGIAVVVLLH ILFIWALMNG LANKVVQIVQ        60
     KPIETKIIEP VKPPPPPPMP TVQLPPPKFT PPPPPFVPPP EVAVTPPPAR APTITHQAVP       120
     IPTPVAPPPP APVAPPAPAK PVSHAVGVVC PNSDEVRRSV GYPQEAQDND ISGDVMISFV       180
     VDPQGHVTDE KVEQSADPIL DRAAFSAVKK FNCISQGQPV RVQVPFSFKL N                231
//

If you have problems or comments...

PBIL Back to PBIL home page