(data stored in ACNUC7421 zone)

EMBL: CP000272.PE363

CP000272.PE363       Location/Qualifiers
FT   CDS             406347..406778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0384"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36291"
FT                   /db_xref="GOA:Q13HZ8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HZ8"
FT                   /protein_id="ABE36291.1"
FT                   /translation="MGMNVSSGGGSGEPEVMVDINTTPLIDVMLVLLIMLIITIPIQMH
FT                   SVKMNLPVGNPPPQAVPPPVVQIDIDFDGTITWNGAPVAAGADLEKHMADVAAQPDQPE
FT                   IHLLPNRLAPYNDVAAVLAAAQREGATKIGLVGNEQYMQ"
     MGMNVSSGGG SGEPEVMVDI NTTPLIDVML VLLIMLIITI PIQMHSVKMN LPVGNPPPQA        60
     VPPPVVQIDI DFDGTITWNG APVAAGADLE KHMADVAAQP DQPEIHLLPN RLAPYNDVAA       120
     VLAAAQREGA TKIGLVGNEQ YMQ                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page