(data stored in ACNUC7421 zone)

EMBL: CP000272.PE367

CP000272.PE367       Location/Qualifiers
FT   CDS             410022..410963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0388"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36295"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HZ4"
FT                   /protein_id="ABE36295.1"
FT                   /translation="MKHSRNILSAVAGTLAALAMGIVGTALAATTFNLSPDQHDRVRTT
FT                   PDAAAIKAVPPSFPFVGKDELVIGMTVGAPPLAAYATDEKTVVGFDPDLAQLVADGLGR
FT                   KLKIVVLAWEDWPLALQSGRVDAILSNVTVTEERKEKFDFSTYRRDVLGFYVANSSPIK
FT                   AIREPKDVAGLRVITDSGTNQEKILLEWNKENVARGLKSVQVQYYDDLAVRDVALRSGR
FT                   ADAILSVNSFLAYEAAQRGEVRAVGTISGGWPILADVAITTRKGSGFAAPLTLLLNDLI
FT                   RSGKYTQVLDRWNLGSEAIDTAKTNPPGLPKS"
     MKHSRNILSA VAGTLAALAM GIVGTALAAT TFNLSPDQHD RVRTTPDAAA IKAVPPSFPF        60
     VGKDELVIGM TVGAPPLAAY ATDEKTVVGF DPDLAQLVAD GLGRKLKIVV LAWEDWPLAL       120
     QSGRVDAILS NVTVTEERKE KFDFSTYRRD VLGFYVANSS PIKAIREPKD VAGLRVITDS       180
     GTNQEKILLE WNKENVARGL KSVQVQYYDD LAVRDVALRS GRADAILSVN SFLAYEAAQR       240
     GEVRAVGTIS GGWPILADVA ITTRKGSGFA APLTLLLNDL IRSGKYTQVL DRWNLGSEAI       300
     DTAKTNPPGL PKS                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page