(data stored in ACNUC7421 zone)

EMBL: CP000272.PE376

CP000272.PE376       Location/Qualifiers
FT   CDS             421410..422354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0397"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36304"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HY5"
FT                   /protein_id="ABE36304.1"
FT                   /translation="MTPRRKFLANFAALSAVSMVWPAGRALADIRSFDFSPEQRGRLRA
FT                   QKNPAAVRLLSNGYRFVEAGVLTVAVAPFAAPLASYATDARTIVGSDPDYAQLVADALG
FT                   LKLAFVPVAWPDWPLGLASGKYDAVISNVGVTEQRKQKFDFTTYRLGLHAFYVPVVSAI
FT                   QSIHEPKDISGLRIITGSGTIQERILLEWNKQNISHGLKEASLQYFDDLDSASLALLSN
FT                   RADVIFNPHAPLAYAAATQGKIRLVGTVNAGWPLRADVAIASRKGAGLAQALTEATNGL
FT                   IAGGRYQAALARWGLETEAIEHSETNPPGYKDA"
     MTPRRKFLAN FAALSAVSMV WPAGRALADI RSFDFSPEQR GRLRAQKNPA AVRLLSNGYR        60
     FVEAGVLTVA VAPFAAPLAS YATDARTIVG SDPDYAQLVA DALGLKLAFV PVAWPDWPLG       120
     LASGKYDAVI SNVGVTEQRK QKFDFTTYRL GLHAFYVPVV SAIQSIHEPK DISGLRIITG       180
     SGTIQERILL EWNKQNISHG LKEASLQYFD DLDSASLALL SNRADVIFNP HAPLAYAAAT       240
     QGKIRLVGTV NAGWPLRADV AIASRKGAGL AQALTEATNG LIAGGRYQAA LARWGLETEA       300
     IEHSETNPPG YKDA                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page