(data stored in ACNUC7421 zone)

EMBL: CP000272.PE382

CP000272.PE382       Location/Qualifiers
FT   CDS             complement(430290..430913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0405"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36310"
FT                   /db_xref="GOA:Q13HX9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX9"
FT                   /protein_id="ABE36310.1"
FT                   /translation="MWFDLSQLSPRDGYKLLSSTIVPRPIAWVVSADANGRLNAAPFSF
FT                   FNLFSDDPPVICLGIMGRAGQQKDTGANIRARGEFVVNLVPERLAHQMNATACEYEHGV
FT                   DELQAADLATAPCPTIAIPRIAESPVALECIPMRYIELGNGRMLIAATVRSVYIDDAAV
FT                   LDRDNCYVDTPALGLVARMHGRGEYARTSNLFTMPRPPTPPASS"
     MWFDLSQLSP RDGYKLLSST IVPRPIAWVV SADANGRLNA APFSFFNLFS DDPPVICLGI        60
     MGRAGQQKDT GANIRARGEF VVNLVPERLA HQMNATACEY EHGVDELQAA DLATAPCPTI       120
     AIPRIAESPV ALECIPMRYI ELGNGRMLIA ATVRSVYIDD AAVLDRDNCY VDTPALGLVA       180
     RMHGRGEYAR TSNLFTMPRP PTPPASS                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page