(data stored in ACNUC7421 zone)

EMBL: CP000272.PE39

CP000272.PE39        Location/Qualifiers
FT   CDS             46310..46687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0040"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35967"
FT                   /db_xref="GOA:Q13IX2"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX2"
FT                   /protein_id="ABE35967.1"
FT                   /translation="MTTHARKHLIAWLGILAMCLIVFAPVVSQLLVSARAGNPDAILCS
FT                   ATLPPADAALHDHGGTLAACGYCDLLADQPGVPTLPAPQAVLIVLVMLLALPVPCTRFT
FT                   PIGAFPSGQPRAPPAFRQISL"
     MTTHARKHLI AWLGILAMCL IVFAPVVSQL LVSARAGNPD AILCSATLPP ADAALHDHGG        60
     TLAACGYCDL LADQPGVPTL PAPQAVLIVL VMLLALPVPC TRFTPIGAFP SGQPRAPPAF       120
     RQISL                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page