(data stored in ACNUC7421 zone)

EMBL: CP000272.PE390

CP000272.PE390       Location/Qualifiers
FT   CDS             437886..438452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0414"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36318"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX1"
FT                   /protein_id="ABE36318.1"
FT                   /translation="MKELNAWTGTGIDSAPLMLSENATSDQRLQRAEAEVRRLARCMEM
FT                   KDRQLCELRKALAHSATVHYSFEDRLQRELDSLRIMMPTTDFRGHWDTPASEQSDEGFV
FT                   VKLPYVTSILSVLFDAMYTFWAGCDHDHPPKSTTVAHAIDERLGLTSQSNGEASRSGQA
FT                   YASAIRPDRVKEADNRHHGRSPGGR"
     MKELNAWTGT GIDSAPLMLS ENATSDQRLQ RAEAEVRRLA RCMEMKDRQL CELRKALAHS        60
     ATVHYSFEDR LQRELDSLRI MMPTTDFRGH WDTPASEQSD EGFVVKLPYV TSILSVLFDA       120
     MYTFWAGCDH DHPPKSTTVA HAIDERLGLT SQSNGEASRS GQAYASAIRP DRVKEADNRH       180
     HGRSPGGR                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page