(data stored in ACNUC7421 zone)

EMBL: CP000272.PE391

CP000272.PE391       Location/Qualifiers
FT   CDS             complement(438475..439224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0415"
FT                   /product="Putative autoinducer synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36319"
FT                   /db_xref="GOA:Q13HX0"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HX0"
FT                   /protein_id="ABE36319.1"
FT                   /translation="MSFVVAGRLDDLPSHIRHDLGTFRHQVFIQRLHWEIPGVPRDAIS
FT                   EWDEFDGGSTVHLVALSANDRVCGCARLMPTTGPYLLRDVFPELTGAGSPPSSPSVWEM
FT                   SRFAGSGLTDHRTGSASGMSLFPYAMSLARSFGATRLIGVVTRPVARLYRRFGLDLRHI
FT                   GASSSPGHADIVACAIDLTTATFDKLQCDADSLLRSISCLGHLPRPQQSLCAPLKAKEE
FT                   GLHSAVSRDETSFPACGSGTARTERAI"
     MSFVVAGRLD DLPSHIRHDL GTFRHQVFIQ RLHWEIPGVP RDAISEWDEF DGGSTVHLVA        60
     LSANDRVCGC ARLMPTTGPY LLRDVFPELT GAGSPPSSPS VWEMSRFAGS GLTDHRTGSA       120
     SGMSLFPYAM SLARSFGATR LIGVVTRPVA RLYRRFGLDL RHIGASSSPG HADIVACAID       180
     LTTATFDKLQ CDADSLLRSI SCLGHLPRPQ QSLCAPLKAK EEGLHSAVSR DETSFPACGS       240
     GTARTERAI                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page