(data stored in SCRATCH zone)

EMBL: CP000272.PE394

CP000272.PE394       Location/Qualifiers
FT   CDS             complement(441420..442412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36322"
FT                   /db_xref="GOA:Q13HW7"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW7"
FT                   /protein_id="ABE36322.1"
FT                   /translation="MESSLRATGHPGWDAWMRSWHPDYGHWLEAWPGEEAAGSPPVHLA
FT                   GLVTPDMNCMVPVETGTDLSGLAAKVTKAICRARPPDARPVEIIVFCHSSLDEHVSTTV
FT                   AGRLCAEVGTPCFPFSISQQHGVSPFTALRIASDLFIAEPDIHTILIVAAEKWRPPFSR
FT                   MCGPGIVHGDAAGALLIERTHQGGTNLQLLDAATRHVPVDIGIRASGIPDTPTSALTSM
FT                   IDFLLARHDLRHEDIDEVVGHPGIPSLTRSVGELLNRPAARAQHAVCVHLGAAESIVRL
FT                   AQTLTRGTFRQRHRMLLWGYGIGGSVGTVLLEACCAPFRCQQDAVWSVS"
     MESSLRATGH PGWDAWMRSW HPDYGHWLEA WPGEEAAGSP PVHLAGLVTP DMNCMVPVET        60
     GTDLSGLAAK VTKAICRARP PDARPVEIIV FCHSSLDEHV STTVAGRLCA EVGTPCFPFS       120
     ISQQHGVSPF TALRIASDLF IAEPDIHTIL IVAAEKWRPP FSRMCGPGIV HGDAAGALLI       180
     ERTHQGGTNL QLLDAATRHV PVDIGIRASG IPDTPTSALT SMIDFLLARH DLRHEDIDEV       240
     VGHPGIPSLT RSVGELLNRP AARAQHAVCV HLGAAESIVR LAQTLTRGTF RQRHRMLLWG       300
     YGIGGSVGTV LLEACCAPFR CQQDAVWSVS                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page