(data stored in ACNUC7421 zone)

EMBL: CP000272.PE395

CP000272.PE395       Location/Qualifiers
FT   CDS             complement(442481..443089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36323"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HW6"
FT                   /protein_id="ABE36323.1"
FT                   /translation="MSSQDPAVEPAHRTDGPHRTGGESGSCWLREPDSDDVNDIAAWLA
FT                   EQHINQWFDFGQGRQTLSVLAVRFMIQSGRHRIRMFGPAGHEAASGLVAVSDLAHAFGT
FT                   GSFWVLRDSRRPACRDMTFTASTMLLREAFEADRLHCITAWAVECNVRSRHLLERIGFH
FT                   LIGQQRDCHVMYGSRYGRVHYDLLPADLVDDTGSPQRGA"
     MSSQDPAVEP AHRTDGPHRT GGESGSCWLR EPDSDDVNDI AAWLAEQHIN QWFDFGQGRQ        60
     TLSVLAVRFM IQSGRHRIRM FGPAGHEAAS GLVAVSDLAH AFGTGSFWVL RDSRRPACRD       120
     MTFTASTMLL REAFEADRLH CITAWAVECN VRSRHLLERI GFHLIGQQRD CHVMYGSRYG       180
     RVHYDLLPAD LVDDTGSPQR GA                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page